Scaffold Ga0168097_1004547

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0168097_1004547

Scaffold Ga0168097_1004547

Overview

Basic Information
Taxon OID	3300029255 Open in IMG/M
Scaffold ID	Ga0168097_1004547 Open in IMG/M
Source Dataset Name	Biosolids microbial communities from sewage treatment plant in Sweden - SWESTP9 - Uppsala-digested 110
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Gothenburg
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	5405
Total Scaffold Genes	11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Biosolids → Sewage Microbial Communities From Wastewater Treatment Plant In Sweden

Source Dataset Sampling Location
Location Name	Sweden
Coordinates	Lat. (^o)	59.844519	Long. (^o)	17.659844	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F105264	Metagenome / Metatranscriptome	100	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0168097_10045475	F105264	N/A	MIEKLHPLAVGICSLLFGEGIGFLFVSSESIVYQILRILSYFVSIIASILAIVLSVKKLQENEQRNNKATTNKDES

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.