NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0119977_101035

Scaffold Ga0119977_101035


Overview

Basic Information
Taxon OID3300029149 Open in IMG/M
Scaffold IDGa0119977_101035 Open in IMG/M
Source Dataset NameMarine sediment microbial communities from University of Hong Kong - Deep-ocean Sediment
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Hong Kong
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)725
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → Thermococci → Thermococcales → Thermococcaceae → Pyrococcus → Pyrococcus horikoshii → Pyrococcus horikoshii OT3(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Deep-Ocean Sediment → Environmental Microbial Communities From Various Locations To Study Antibiotic Resistance - The University Of Hong Kong

Source Dataset Sampling Location
Location Name
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F095628Metagenome105Y

Sequences

Protein IDFamilyRBSSequence
Ga0119977_1010351F095628N/AVYMYLRDFCFCIRNPSAALAMKYGSEPFYDSWASSYAYKMRI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.