NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0169171_103269

Scaffold Ga0169171_103269


Overview

Basic Information
Taxon OID3300029098 Open in IMG/M
Scaffold IDGa0169171_103269 Open in IMG/M
Source Dataset NameHuman fecal microbial communities from infant at 12 months in Denmark - 10_12M
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBeijing Genomics Institute (BGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4078
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (12.50%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Host-Associated → Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark

Source Dataset Sampling Location
Location NameDenmark
CoordinatesLat. (o)55.676097Long. (o)12.568337Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F098313Metagenome104N

Sequences

Protein IDFamilyRBSSequence
Ga0169171_1032697F098313N/AMIITVGLDYKTLCDRFENMEPEHEGKWGDEDDMDKEASFVNLVRDRDNDDQFAILWNFSSDDDIMMRNICHESFHIAMSVCQFCNMSLGFKVGEDEHAAYIAGFAGHCVGEFINSKNTD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.