Scaffold Ga0169699_117925

Overview

Basic Information

• Taxon OID: 3300029056
• Scaffold ID: Ga0169699_117925
• Source Dataset Name: Human fecal microbial communities from mother in Denmark - 397_M
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Beijing Genomics Institute (BGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1619
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Host-Associated → Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark

Source Dataset Sampling Location

• Location Name: Denmark
• Coordinates
  • Lat. (^o): 55.678
  • Long. (^o): 12.531

Associated Families

Family	Category	Number of Sequences	3D Structure?
F068811	Metagenome	124	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0169699_1179252	F068811	AGGA	MDQDGSEHNICSNREGLCPGKEQHGASGWKKIFQHGKEPLRNKDSVSQYCNKKAAVSLILNENVSETLCIFSIDKTNCCRIK