Scaffold Ga0169649_103412

Overview

Basic Information

• Taxon OID: 3300029039
• Scaffold ID: Ga0169649_103412
• Source Dataset Name: Human fecal microbial communities from mother in Denmark - 335_M
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Beijing Genomics Institute (BGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 6541
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (57.14%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Host-Associated → Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark

Source Dataset Sampling Location

• Location Name: Denmark
• Coordinates
  • Lat. (^o): 55.678
  • Long. (^o): 12.531

Associated Families

Family	Category	Number of Sequences	3D Structure?
F039198	Metagenome	164	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0169649_1034125	F039198	AGG	MKLTITEIQGTKYVQIYLTEDELQKKETKDLIKKYKQEKYSMAIFVTGKENYPEILGKIITKQVELNRNVC