Scaffold Ga0169656_100661

Overview

Basic Information

• Taxon OID: 3300028998
• Scaffold ID: Ga0169656_100661
• Source Dataset Name: Human fecal microbial communities from newborn in Denmark - 341_B
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Beijing Genomics Institute (BGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 16651
• Total Scaffold Genes: 17
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 16 (94.12%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Coriobacteriia → Coriobacteriales → Coriobacteriaceae → Collinsella → unclassified Collinsella → Collinsella sp. 4_8_47FAA (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Host-Associated → Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark

Source Dataset Sampling Location

• Location Name: Denmark
• Coordinates
  • Lat. (^o): 55.678
  • Long. (^o): 12.531

Associated Families

Family	Category	Number of Sequences	3D Structure?
F099269	Metagenome	103	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0169656_10066114	F099269	GGAGG	VHGVLVSAQVGELLLLDDLGDRASGASVLASATGDAGVLVSDGSDVLELQNASGAGVDANATSDALVGINYGMSHGSFLSVDRRYRRCASV