Scaffold Ga0310376_1001122

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0310376_1001122

Scaffold Ga0310376_1001122

Overview

Basic Information
Taxon OID	3300028916 Open in IMG/M
Scaffold ID	Ga0310376_1001122 Open in IMG/M
Source Dataset Name	Lab enriched sediment microbial communities from oil refinery in Oklahoma, USA. Combined Assembly of Gp0220779, Gp0324998
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Toronto, Beijing Genomics Institute (BGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	32132
Total Scaffold Genes	43 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	33 (76.74%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Anaerobic Enrichment Culture → Metagenomes From Methanogenic Benzene-Degrading Culture

Source Dataset Sampling Location
Location Name	USA: Oklahoma
Coordinates	Lat. (^o)	36.0	Long. (^o)	-97.0	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F090409	Metagenome	108	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0310376_100112242	F090409	AGGGGG	VKKEFAGTLQASFGMMGSVHLNLELSGSVIGDTNQFLDGARGKRVLVTVETQELEP

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.