Scaffold Ga0308309_10003415

Overview

Basic Information

• Taxon OID: 3300028906
• Scaffold ID: Ga0308309_10003415
• Source Dataset Name: Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 9492
• Total Scaffold Genes: 9
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (55.56%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil → Soil Microbial Communities From The Hubbard Brook Experimental Forest, New Hampshire, Under Manipulated Climate Change Conditions.

Source Dataset Sampling Location

• Location Name: USA: New Hampshire, Hubbard Brook experimental Forest
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F049124	Metagenome / Metatranscriptome	147	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0308309_100034156	F049124	N/A	VIAALFFLVAGYLATIGIIELVAPGTFSTTLGSGITYGRELTGPQTAISVGAGWALVGWGLYRLRNWARLCAILLMVIGIAGSVPEVSAAARDLTWRFWFYGTQIMVRVVIAWYLVASPELIEAFARK