NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0308309_10002415

Scaffold Ga0308309_10002415


Overview

Basic Information
Taxon OID3300028906 Open in IMG/M
Scaffold IDGa0308309_10002415 Open in IMG/M
Source Dataset NameWarmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)11152
Total Scaffold Genes17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)14 (82.35%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil → Soil Microbial Communities From The Hubbard Brook Experimental Forest, New Hampshire, Under Manipulated Climate Change Conditions.

Source Dataset Sampling Location
Location NameUSA: New Hampshire, Hubbard Brook experimental Forest
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F045238Metagenome / Metatranscriptome153Y
F064947Metagenome / Metatranscriptome128Y
F095822Metagenome / Metatranscriptome105Y

Sequences

Protein IDFamilyRBSSequence
Ga0308309_1000241514F045238AGGGGGMSEGYDIFRDLEETGPIWIEAVQGLENAKARVSELLATRPGNYFIYDPFAAKVIASAFKSAQMQAPVTLAGRCHQY
Ga0308309_100024152F095822GAGGMDLGFDIFRTMDDGTPLWIKQVPTLDEGRQHLEALVSAAPGEYFIRNASTGEIALRLGGISNP
Ga0308309_100024158F064947AGGAMDQAAAATKNPATILPRESAAQFQSSAVPPVVLVATTDPVISESMHNLLQMYPLRTLWAKGVGEVRALLAKENVSACFCGFWLVDGTYRDVVRLLKRQPVEIPAIIVCEPACPNEYRDYLAALNIRAFDFICHPYRKTDLVRILQATLSERAHAARLRGSLVDTVNVLETRAGLG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.