NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0247609_10037717

Scaffold Ga0247609_10037717


Overview

Basic Information
Taxon OID3300028888 Open in IMG/M
Scaffold IDGa0247609_10037717 Open in IMG/M
Source Dataset NameSheep rumen microbial communities from Palmerston North, Manawatu-Wanganui, New Zealand - 1728 DNA GHGlow gp2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4427
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (25.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen → Rumen Microbial Communities From Sheep, Dairy Cows And Beef Cattle From Various Locations

Source Dataset Sampling Location
Location NameNew Zealand: Palmerston North, Manawatu-Wanganui
CoordinatesLat. (o)-40.3794Long. (o)175.6106Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F064301Metagenome / Metatranscriptome128Y
F075545Metagenome / Metatranscriptome118Y
F079361Metagenome / Metatranscriptome116Y

Sequences

Protein IDFamilyRBSSequence
Ga0247609_1003771711F064301GGAMAKAKGITTRTVRLPTKVTPVWQIGMLFPNGQKISKPKCTLNEIFNTYFINLDKYLSKGLSAEELLEKYKETFTKGNIKIQINYIDSWGHTWKGKVAWPKESKFIEYLNKRLNENYS
Ga0247609_100377175F075545N/AMIQLVVNVNLLREIDERKLINAYARLIYEKESDITDDNVIKVNLINLFDWDINGDNGLGIYCGKFESIKRKDWDILIQFIKDNGYEIEKISRTPLKEKRLENIKIVNDFLEAKEQHNIERFTDNNYQVSGRGKKAKPCIYNGKEYKSRQECIYKECITKYQLYEYLKETNQL
Ga0247609_100377179F079361N/AMIYFTISKNECGYLIDSISEDYATLKLKFPNETIYHSDEPIVSIYVIKDQLKSVK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.