Scaffold Ga0302278_10171036

Overview

Basic Information

• Taxon OID: 3300028866
• Scaffold ID: Ga0302278_10171036
• Source Dataset Name: Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1109
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog → Peat Permafrost Microbial Communities From Stordalen Mire Near Abisko, Sweden

Source Dataset Sampling Location

• Location Name: Sweden: Abisko, Stordalen Mire
• Coordinates
  • Lat. (^o): 68.3532
  • Long. (^o): 19.0477
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F027187	Metagenome / Metatranscriptome	195	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0302278_101710362	F027187	N/A	MDAVLRKYTSFDEMKADEYRYWQSRPVHERMDAVEEMIQAAYALKGWEIEPE