Scaffold Ga0307326_111663

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0307326_111663

Scaffold Ga0307326_111663

Overview

Basic Information
Taxon OID	3300028846 Open in IMG/M
Scaffold ID	Ga0307326_111663 Open in IMG/M
Source Dataset Name	Metatranscriptome of enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAT_UR_Ala1 (Metagenome Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	707
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location
Location Name	USA: Wisconsin
Coordinates	Lat. (^o)	44.11	Long. (^o)	-88.23	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059033	Metagenome / Metatranscriptome	134	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0307326_1116631	F059033	GGA	MAITTANLQALAAAWDVGTEFEPIVIDMLRISSFLRTAVAAKASHGIKHEYRFFKSLPLAVFREIGEGIVPQKIGPDKAQIDLKELVFDLYEDYQGILQYPGGKEGWLKDYYPIALMALTNAITQSSFYGNIPGFGYEKAFKGFHQYAKDLGQVVAQKGGSSGSCSSIFAVRWEKFDGASLRFNNTELLNVIDVTPNQPIPIVTDT

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.