Scaffold Ga0247825_10000119

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0247825_10000119

Scaffold Ga0247825_10000119

Overview

Basic Information
Taxon OID	3300028812 Open in IMG/M
Scaffold ID	Ga0247825_10000119 Open in IMG/M
Source Dataset Name	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	43916
Total Scaffold Genes	29 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	19 (65.52%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil → Soil Microbial Communities From Agricultural Site In Penn Yan, New York, United States

Source Dataset Sampling Location
Location Name	USA: New York
Coordinates	Lat. (^o)	42.673	Long. (^o)	-77.032	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F099834	Metagenome	103	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0247825_1000011922	F099834	N/A	LPQFSLEAFRLINTVELALVVAIVFVAAFMARGAWLF

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.