Scaffold Ga0268298_10571544

Overview

Basic Information

• Taxon OID: 3300028804
• Scaffold ID: Ga0268298_10571544
• Source Dataset Name: Activated sludge microbial communities from WWTP in Nijmegen, Gelderland, Netherland - WWTP Weurt
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 541
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Studying Microbial Cell-Cell Associations In A Wide Range Of Aquatic Ecosystems

Source Dataset Sampling Location

• Location Name: Netherlands: Nijmegen, Gelderland
• Coordinates
  • Lat. (^o): 51.82
  • Long. (^o): 5.87

Associated Families

Family	Category	Number of Sequences	3D Structure?
F072817	Metagenome / Metatranscriptome	121	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0268298_105715443	F072817	N/A	CELFAVAYGDVATALSRVSPGSALRVRGFLARRYRTGITVALHINEFAMNEGN