NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0265338_10046974

Scaffold Ga0265338_10046974


Overview

Basic Information
Taxon OID3300028800 Open in IMG/M
Scaffold IDGa0265338_10046974 Open in IMG/M
Source Dataset NameRhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3949
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere → Rhizosphere Microbial Communities From Carex Aquatilis Grown In University Of Washington, Seatle, Wa, United States

Source Dataset Sampling Location
Location NameUSA: Seattle, Washington
CoordinatesLat. (o)47.6516Long. (o)-122.3045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000262Metagenome / Metatranscriptome1428Y
F050243Metagenome / Metatranscriptome145Y
F085928Metagenome / Metatranscriptome111Y

Sequences

Protein IDFamilyRBSSequence
Ga0265338_100469742F000262N/AMSDKRKKLERIYLTSMTILVTLATLSCSGQDFGFLQPTPGDLCKCVPLEPDIADYRHAAKHVPISNLVAQEVTVETILTWSQDLFIPPDAPRTGRELEVFHLANAFLQKASVNAVDCDVSMEISQTADKGSARMIVETPVDSEYCGARQNLQAQLKQHGFQLDSQHGGELPQALPVDIVGMAFEDFEHDRGPVATLWEIHPAIVTLH
Ga0265338_100469745F050243GAGGMAKKVEATVLSTLQDLLIFQMASKGVPQRQIREAVGLEIGRVNRIAKLAKKSSKSEE
Ga0265338_100469746F085928AGGAGMPTEGTERLIELLEKALMIQLHALGAAQGDIAKMLSKSKTDVNSFLKPIAKGKR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.