Scaffold Ga0302208_10156494

Overview

Basic Information

• Taxon OID: 3300028774
• Scaffold ID: Ga0302208_10156494
• Source Dataset Name: Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E2_3
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 559
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen → Peat Permafrost Microbial Communities From Stordalen Mire Near Abisko, Sweden

Source Dataset Sampling Location

• Location Name: Sweden: Abisko, Stordalen Mire
• Coordinates
  • Lat. (^o): 68.3532
  • Long. (^o): 19.0469
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F027506	Metagenome / Metatranscriptome	194	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0302208_101564941	F027506	N/A	ANVEQDAYLAAVAAVNVTGWANHPVAAVRPGAIPLYLGEGAPLYAAGLGTVSFCPTPTYLLQAGDAHRPHQLDLDKLDKRLMYGQILALAQTVEALDAAPAAAL