Basic Information | |
---|---|
Taxon OID | 3300028755 Open in IMG/M |
Scaffold ID | Ga0307316_10109846 Open in IMG/M |
Source Dataset Name | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 967 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From The East River Watershed Near Crested Butte, Colorado, United States |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Colorado | |||||||
Coordinates | Lat. (o) | 38.9206 | Long. (o) | -106.9489 | Alt. (m) | Depth (m) | 10 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F085069 | Metagenome | 111 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0307316_101098462 | F085069 | N/A | MDANGARELTKRLEAQAHWRQATAVQTGEQPTLDPDAQDLDELGEGVRRYGIETQRMTVEGRPALVTHRLCKRLREGRWEATLDVESVDYLEDNVAS |
⦗Top⦘ |