NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0302301_1000028

Scaffold Ga0302301_1000028


Overview

Basic Information
Taxon OID3300028731 Open in IMG/M
Scaffold IDGa0302301_1000028 Open in IMG/M
Source Dataset NamePeat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)182150
Total Scaffold Genes146 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)114 (78.08%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa → Peat Permafrost Microbial Communities From Stordalen Mire Near Abisko, Sweden

Source Dataset Sampling Location
Location NameSweden: Abisko, Stordalen Mire
CoordinatesLat. (o)68.3535Long. (o)19.0473Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000279Metagenome / Metatranscriptome1383Y
F001748Metagenome / Metatranscriptome642Y
F012599Metagenome / Metatranscriptome279Y
F032558Metagenome / Metatranscriptome179Y

Sequences

Protein IDFamilyRBSSequence
Ga0302301_100002825F001748GGAGMKKQLQFSIAVIGAAVLLLASFAWAAPKASKATPQNVPAFPGTLVNARYVYVTSYDGDEFNINLLSEDRQAIVTVQDAMQKWGKFTLVYEPGQADIVLMVMSRPSEDVLAVYDAHGWPRNEYLWRMMGHGGLQQGEAPLVTNLEKAFDLATAK
Ga0302301_100002835F012599AGGAGMKKLMVCLLAVTFAMSLTAVAQQDTMSQDHSMAQTQSDSAAKAPLMTLKGTVKTEGDKVMFVNDKDGKSWDVMNPEELKAHDGHHVQLSAHVYADKNAIHVMSVKMLKAGSMGNDSMSK
Ga0302301_100002872F000279GAGMTHKPDNAAIEEEIILPENLLPLGSVLGEGVSALDVSMVLAKVFRVQYAEVALLRLDGGLLKFIFPEHLRTTGAIPISSKAVAAHTALSKKAEIFNNFARVKHASIFETIKPVGAEAELPATPVPIQKLMSVPILDANSTVLGVLQISRKGVDPGYTQDFSREDLHDLELAAGLLAASPIMLAN
Ga0302301_100002893F032558AGGMSVEKMSVEKASGEKTTVEKISRTAHIEKKPAASAGGVQCLRCHNELDSYVFTKFTFLPYGTAGGNVVLECPKCGHIEFMSQNSPLLRRLNAKPVAVGDGD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.