Scaffold Ga0307338_112008

Overview

Basic Information

• Taxon OID: 3300028724
• Scaffold ID: Ga0307338_112008
• Source Dataset Name: Metatranscriptome of enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAT_UR_Gln1 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 811
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location

• Location Name: USA: Wisconsin
• Coordinates
  • Lat. (^o): 44.11
  • Long. (^o): -88.23

Associated Families

Family	Category	Number of Sequences	3D Structure?
F045183	Metagenome / Metatranscriptome	153	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0307338_1120082	F045183	GGAGG	MKNKETLKRLSDRLLRPALRESEIIKTLSGLPGVRPFLYEFKLGPLFLISAWLFLFHANYTGAAEEWLLYFFGAGAVVGVLSVHKAVMRFLYRIAQFEKPVEGQDRTIMITAE