Scaffold Ga0307360_110272

Overview

Basic Information

• Taxon OID: 3300028723
• Scaffold ID: Ga0307360_110272
• Source Dataset Name: Metatranscriptome of enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAT_UR_Val1 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 785
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium ADurb.BinA179 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location

• Location Name: USA: Wisconsin
• Coordinates
  • Lat. (^o): 44.11
  • Long. (^o): -88.23

Associated Families

Family	Category	Number of Sequences	3D Structure?
F058971	Metagenome / Metatranscriptome	134	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0307360_1102721	F058971	GGAGG	MTPNLIINLDIEPITLMWNGQAISLPGTYELVPDNEIKHLHKRVVAVALHERRRVPLYGRVVGKARYGKHSVWLIE