Scaffold Ga0307315_10311754

Overview

Basic Information

• Taxon OID: 3300028721
• Scaffold ID: Ga0307315_10311754
• Source Dataset Name: Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 500
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From The East River Watershed Near Crested Butte, Colorado, United States

Source Dataset Sampling Location

• Location Name: USA: Colorado
• Coordinates
  • Lat. (^o): 38.9206
  • Long. (^o): -106.9489
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026704	Metagenome / Metatranscriptome	197	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0307315_103117541	F026704	N/A	ENAIRFSNYFHVLRELVHMTAAWLPLVGDFETKYLLSDHLHDDARAISKVRRRLYELRHPSDYPGAPGSELTEMLDAMEAHHSPEDYLRQAYGVAKPALIAAMRIHLDTLDPVCDEPTLRLLRQVVSRQERHVEALGGEFGGSTAVADIGTLEIRLKAPPREMRIL