Scaffold Ga0257128_1115620

Overview

Basic Information

• Taxon OID: 3300028672
• Scaffold ID: Ga0257128_1115620
• Source Dataset Name: Metatranscriptome of marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10m (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 538
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location

• Location Name: Canada: Northeast Subartic Pacific Ocean
• Coordinates
  • Lat. (^o): 50.0
  • Long. (^o): -145.0
  • Depth (m): 10

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010769	Metagenome / Metatranscriptome	299	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0257128_11156201	F010769	N/A	PVFLGPDLGFVNIMQYNDADGSCEIDILELGAVCSGEMFQTCLDFLESSELEPQCESVYLGPDMGFVNIMAYNDADGTCEISMVELQAVCSGAMFQTCLDFLQSSEDEPQCEGVFLGPDLGFVNVMAYNDVDGTCELSIQELAAVCSGDMLATCLAFLESSEPSAQPQCEPVFLGDAMG