Scaffold Ga0268299_1051545

Overview

Basic Information

• Taxon OID: 3300028648
• Scaffold ID: Ga0268299_1051545
• Source Dataset Name: Activated sludge microbial communities from bioreactor in Nijmegen, Gelderland, Netherland - NOB reactor
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1330
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Studying Microbial Cell-Cell Associations In A Wide Range Of Aquatic Ecosystems

Source Dataset Sampling Location

• Location Name: Netherlands: Nijmegen, Gelderland
• Coordinates
  • Lat. (^o): 51.82
  • Long. (^o): 5.87

Associated Families

Family	Category	Number of Sequences	3D Structure?
F089567	Metagenome / Metatranscriptome	109	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0268299_10515452	F089567	N/A	MAATETIQFQATPELRQQLEEAAAQLNLSLSAYVLYLYEKMAPGRDGARLDRHVQEVFGKHGELMRRLAK