Scaffold Ga0268299_1000134

Overview

Basic Information

• Taxon OID: 3300028648
• Scaffold ID: Ga0268299_1000134
• Source Dataset Name: Activated sludge microbial communities from bioreactor in Nijmegen, Gelderland, Netherland - NOB reactor
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 288478
• Total Scaffold Genes: 262
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 157 (59.92%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Studying Microbial Cell-Cell Associations In A Wide Range Of Aquatic Ecosystems

Source Dataset Sampling Location

• Location Name: Netherlands: Nijmegen, Gelderland
• Coordinates
  • Lat. (^o): 51.82
  • Long. (^o): 5.87

Associated Families

Family	Category	Number of Sequences	3D Structure?
F040517	Metagenome	161	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0268299_1000134180	F040517	N/A	MGDKDKLRKIGDSMKEMAHFAEEQRLGHGRIEFDELGNAVWVPASGDASAEVMRRLLDDPSLAFSNDYSGGSVKRIQQNQLGLKKGYDPYDSGHLVKKQWKSKKDLRKLSEWIKSKRPKD