Scaffold Ga0272412_1259388

Overview

Basic Information

• Taxon OID: 3300028647
• Scaffold ID: Ga0272412_1259388
• Source Dataset Name: Metatranscriptome of activated sludge microbial communities from WWTP in Nijmegen, Gelderland, Netherland - WWTP Weurt (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 707
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Orthoptera → Caelifera → Acrididea → Acridomorpha → Acridoidea → Acrididae → Cyrtacanthacridinae → Schistocerca → Schistocerca gregaria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Studying Microbial Cell-Cell Associations In A Wide Range Of Aquatic Ecosystems

Source Dataset Sampling Location

• Location Name: Netherlands: Nijmegen, Gelderland
• Coordinates
  • Lat. (^o): 51.82
  • Long. (^o): 5.87

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001616	Metagenome / Metatranscriptome	662	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0272412_12593881	F001616	GAG	MGGKQSMVGLKMMEAIYPSKSPTVFTDPKLKTILDKEVLKLHLKLDDLEPDEIAVDGDLDADIDRCITMVFQVYDRKKTGSIRKKDAEEFFKDCLELYALRQGKKSSKEILPKNVKMDKALADCVKKMSPSTAPVVTKEEFEKFLNCYDIEEALEPFFSTNGIDIDGNVSYVDTSVFSSAQREGPKLVYRDYPDD