Basic Information | |
---|---|
Taxon OID | 3300028647 Open in IMG/M |
Scaffold ID | Ga0272412_1166041 Open in IMG/M |
Source Dataset Name | Metatranscriptome of activated sludge microbial communities from WWTP in Nijmegen, Gelderland, Netherland - WWTP Weurt (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 925 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Studying Microbial Cell-Cell Associations In A Wide Range Of Aquatic Ecosystems |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Netherlands: Nijmegen, Gelderland | |||||||
Coordinates | Lat. (o) | 51.82 | Long. (o) | 5.87 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F052619 | Metagenome / Metatranscriptome | 142 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0272412_11660411 | F052619 | N/A | KQLNSQIMRSPVYRPVYKFTRVSEDTSFNIVCDGINPTLSAFFFMLSQVPNSADFTNLFDMYCLKKIEIDWVPEYTELTDAAPLSNAVNVRVNSAIDLTDNLAPASVNEVLQFQQLVSTGITKPHMRSWQPTFLMGGLVPCSCWLPTSSSTERHYGLKIGVPPTGVAMILRAKVKYFVECANVS |
⦗Top⦘ |