NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0272412_1028610

Scaffold Ga0272412_1028610


Overview

Basic Information
Taxon OID3300028647 Open in IMG/M
Scaffold IDGa0272412_1028610 Open in IMG/M
Source Dataset NameMetatranscriptome of activated sludge microbial communities from WWTP in Nijmegen, Gelderland, Netherland - WWTP Weurt (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2328
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Studying Microbial Cell-Cell Associations In A Wide Range Of Aquatic Ecosystems

Source Dataset Sampling Location
Location NameNetherlands: Nijmegen, Gelderland
CoordinatesLat. (o)51.82Long. (o)5.87Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F029893Metagenome / Metatranscriptome187Y

Sequences

Protein IDFamilyRBSSequence
Ga0272412_10286103F029893AGGAGGMPVMQDSVSVAANSVSANVVAGQLYEFVPTGTKVTLSCTGSATGLRATLIANIPVMNDQAINLQNRFPIIPDDIVFQGAVRACRIVLTARNTTAGALTFFWRIDVN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.