NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0302159_10012784

Scaffold Ga0302159_10012784


Overview

Basic Information
Taxon OID3300028646 Open in IMG/M
Scaffold IDGa0302159_10012784 Open in IMG/M
Source Dataset NamePeat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1868
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen → Peat Permafrost Microbial Communities From Stordalen Mire Near Abisko, Sweden

Source Dataset Sampling Location
Location NameSweden: Abisko, Stordalen Mire
CoordinatesLat. (o)68.3532Long. (o)19.0469Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004753Metagenome / Metatranscriptome425Y
F010341Metagenome / Metatranscriptome305Y
F012089Metagenome / Metatranscriptome284Y

Sequences

Protein IDFamilyRBSSequence
Ga0302159_100127841F012089N/AIDLYEKDGRLLVRYTVCNHGTEPYAIDTPLVYQLDGVRSAQSLYGLQNSQLGDEQAAKLKIKQETPVKVLDGQLQTAQVAPGQEAVGVVALDMASSTQPTVLRFQFPGSKQSEDGLSNGQQMQIAAFLVR
Ga0302159_100127842F010341GAGGMADPFTVKPVYNALSQYIRNRADIGAGRAMRDGVLEPSNPFERKAARPPRRWFVLLSLLAAMVLGFFLYFNNLL
Ga0302159_100127843F004753AGGMNDQNDANGVRPPVPTELASDAREQIRDWEFLFWAYLLFGLGRLAWLYLYQPENKGFHLGLSCGFVFCGVLGFLMRWVFSPKRGK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.