NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0302238_1095360

Scaffold Ga0302238_1095360


Overview

Basic Information
Taxon OID3300028644 Open in IMG/M
Scaffold IDGa0302238_1095360 Open in IMG/M
Source Dataset NameEnriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Asn
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)743
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Activated Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)44.11Long. (o)-88.23Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F078675Metagenome / Metatranscriptome116N

Sequences

Protein IDFamilyRBSSequence
Ga0302238_10953601F078675AGGAGMPDNFGRMTSDEAPQSLKDFCFPKQEQKEESIHKHTPGPWTIYNHAGTNSGHYDGYLKSDIRAGADLIHIRQSVAGNTFPRLAANVRLMAAAPSMHDALWAIANMQVQEETDKGEVLALCMSIARLELEKCSTAGK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.