Scaffold Ga0302247_1049841

Overview

Basic Information

• Taxon OID: 3300028630
• Scaffold ID: Ga0302247_1049841
• Source Dataset Name: Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Ile
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1085
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin212 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Activated Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location

• Location Name: USA: Wisconsin
• Coordinates
  • Lat. (^o): 44.11
  • Long. (^o): -88.23

Associated Families

Family	Category	Number of Sequences	3D Structure?
F071211	Metagenome / Metatranscriptome	122	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0302247_10498411	F071211	N/A	YKSWQVPVWQAVDVNTIAQWHATRRLQLEIGKEVKLRVLMSYDLVNSIIAQGGIRRAVKWRGQQYYLTNMTIRSDSDIVDITLLPLLSYSGEIGGKPLPTTIPTGVMASAGGNYVIALSDDTVMTLS