Scaffold Ga0257136_1011717

Overview

Basic Information

• Taxon OID: 3300028619
• Scaffold ID: Ga0257136_1011717
• Source Dataset Name: Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2010_1_5_45m (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1728
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location

• Location Name: Canada: British Columbia
• Coordinates
  • Lat. (^o): 49.68
  • Long. (^o): -124.009
  • Depth (m): 45

Associated Families

Family	Category	Number of Sequences	3D Structure?
F019930	Metagenome / Metatranscriptome	227	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0257136_10117172	F019930	AGGAG	MRKLNLRDYIIKTKLPDKMNPMQEIDTEYPYHVKDTILNLMFIPQLQLTGAELVKQNVLAMKLEACKDDEIILEDAEYDRIKRAFDTFRGFGRFDVELVTRINEAEVVEVEPKK