Scaffold Ga0265306_10549239

Overview

Basic Information

• Taxon OID: 3300028598
• Scaffold ID: Ga0265306_10549239
• Source Dataset Name: Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160420 (Illumina Assembly)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 635
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location

• Location Name: Atlantic Ocean: North Sea, Helgoland
• Coordinates
  • Lat. (^o): 54.1817
  • Long. (^o): 7.9018
  • Depth (m): 8

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059979	Metagenome / Metatranscriptome	133	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0265306_105492391	F059979	AGGAG	MQSFFFVLALLVLVTIIYTFAYRMGYRDAQAKALFAVRQFADPVTCLLDK