Basic Information | |
---|---|
Taxon OID | 3300028598 Open in IMG/M |
Scaffold ID | Ga0265306_10012372 Open in IMG/M |
Source Dataset Name | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160420 (Illumina Assembly) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 4067 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (80.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment → Pelagic Marine Microbial Communities From North Sea |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Atlantic Ocean: North Sea, Helgoland | |||||||
Coordinates | Lat. (o) | 54.1817 | Long. (o) | 7.9018 | Alt. (m) | Depth (m) | 8 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F054878 | Metagenome | 139 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0265306_100123723 | F054878 | GAGG | MTDLLKKFSAAAQTVKSNNNPLRVCVYGAYREHLKDINPDDLPDNIQIIYESVKDRLTSVRPKGDIGEDEAGYLAEDILHMAEVVKTNYKRS |
⦗Top⦘ |