Scaffold Ga0304731_10745153

Overview

Basic Information

• Taxon OID: 3300028575
• Scaffold ID: Ga0304731_10745153
• Source Dataset Name: Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 683
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location

• Location Name: Southern Ocean
• Coordinates
  • Lat. (^o): 18.7998
  • Long. (^o): -20.70285

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018614	Metagenome / Metatranscriptome	234	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0304731_107451532	F018614	N/A	MEKVTNMAQKLGIPMTPELMQLGNNEAISNALVEIAVGMGKSESEIGAALD