Scaffold Ga0302151_10002836

Overview

Basic Information

• Taxon OID: 3300028562
• Scaffold ID: Ga0302151_10002836
• Source Dataset Name: Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_3
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 7789
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (25.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog → Peat Permafrost Microbial Communities From Stordalen Mire Near Abisko, Sweden

Source Dataset Sampling Location

• Location Name: Sweden: Abisko, Stordalen Mire
• Coordinates
  • Lat. (^o): 68.3532
  • Long. (^o): 19.0477
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F068516	Metagenome / Metatranscriptome	124	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0302151_100028368	F068516	GAG	MTHDPKPPRQPLFWAAVAFSLGLWVGVRAWRPPLWWVIAVAVFVFAASWFLRKRAWLAKALSLGAWVLLGALLIQVRGQRPDEPSQDGARLFALADG