Scaffold Ga0255343_1075450

Overview

Basic Information

• Taxon OID: 3300028561
• Scaffold ID: Ga0255343_1075450
• Source Dataset Name: Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant16
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Restricted
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).

Scaffold Components

• Scaffold Length (bps): 1571
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Built Environment → Water Treatment Plant → Unclassified → Unclassified → Wastewater → Methane Metabolizing Microbial Communities From Different Methane-Rich Environments From Various Locations

Source Dataset Sampling Location

• Location Name: Canada: Vancouver, British Columbia
• Coordinates
  • Lat. (^o): 49.1150727
  • Long. (^o): -123.147
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018007	Metagenome / Metatranscriptome	237	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0255343_10754501	F018007	GAG	MFSGWKITNILDVVPCELDTVDGPYSKTGYRLERREDGFAVTVGLMEHITGWSVWEILGWLNEKQAIPRRYDNENRRTKRTQSRSGVSG