Scaffold Ga0302047_10707228

Overview

Basic Information

• Taxon OID: 3300028554
• Scaffold ID: Ga0302047_10707228
• Source Dataset Name: Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 3A (Eukaryote Community Metatranscriptome) (v9)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 609
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies

Source Dataset Sampling Location

• Location Name: New Mexico, USA
• Coordinates
  • Lat. (^o): 35.8911
  • Long. (^o): -106.2978

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011159	Metagenome / Metatranscriptome	294	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0302047_107072281	F011159	N/A	SCFIYTYFVNSNPIKMVSNSLIYTLLLTMGFLLLINSIQAAPTHNDDEDFDDISSSMDKRTFSNSDIPDGYVGIMLGKRRLESRGVRLPTEAILLGKRRLPYEAVLLGKRDLPNEAILLGKRRIPHEAVLLGKRDLPNEAILLGKRDLPNEAVLLGKRDLPNEGILLGK