Basic Information | |
---|---|
Taxon OID | 3300028531 Open in IMG/M |
Scaffold ID | Ga0233385_1006335 Open in IMG/M |
Source Dataset Name | Fecal eukaryotic communites from dung pellets of Tule Elk in California, USA - Elk Dung G36 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 3410 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Iamiaceae → Aquihabitans → unclassified Aquihabitans → Aquihabitans sp. Kera 3 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Elk Feces → Fecal Eukaryotic Communites From Dung Pellets Of Tule Elk In California, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: California | |||||||
Coordinates | Lat. (o) | 38.04 | Long. (o) | -122.5 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F101280 | Metagenome | 102 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0233385_10063355 | F101280 | N/A | LTIRVRIHGEAWTGSFERDHTVLVGRGRTSDIRVGNQLVQGRWTVSKDHAEILWDGTRWRTVNVSDKPGLLSVYEPGYEEVPLEPGREWAPVRHRWSYAIGRPDHRFHVICATDDHLGPAAVIPGDDLLDADGGAFGGASDGSGASDDEQTAGLDTAVALSFTPLERRVLLAYYSAFASLPRPATLEPRAHDDAAHRLGRSRDSTRKAIERVNEKIRVAHDAPAIATGRNVSAEIGRWLARSGILDPDLVPAD |
⦗Top⦘ |