Basic Information | |
---|---|
Taxon OID | 3300028436 Open in IMG/M |
Scaffold ID | Ga0256397_1000127 Open in IMG/M |
Source Dataset Name | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - Kryos LI F3 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 5364 |
Total Scaffold Genes | 8 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (37.50%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → Viruses → environmental samples → uncultured marine virus | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater → Extreme Environments Viral Communities From Various Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Mediterranean Sea | |||||||
Coordinates | Lat. (o) | 34.9283 | Long. (o) | 22.0216 | Alt. (m) | Depth (m) | 3337 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F019751 | Metagenome / Metatranscriptome | 228 | N |
F079216 | Metagenome / Metatranscriptome | 116 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0256397_10001273 | F019751 | AGG | VSNTLTRTRGPELSKDFKNYIFNQWMFFGKNAYQITETINKDTKLMSQFGKCSPAGVHYHIKNIEADLEDTISEDAMDTYIGEFIRARTGFENDVADVEDLMIHEKKKGLDDMDKELYLKLSRFRHEIKLDSFKMLQDSALPLQVKKLKMERNKLRPQKPVPEVINKVEEDGERTSE |
Ga0256397_10001275 | F079216 | N/A | MYDVCTKCDHGMILHGSVDGVGYCMEGNGNWCECTVEGLTYEQEIESLK |
⦗Top⦘ |