NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0256397_1000127

Scaffold Ga0256397_1000127


Overview

Basic Information
Taxon OID3300028436 Open in IMG/M
Scaffold IDGa0256397_1000127 Open in IMG/M
Source Dataset NameSeawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - Kryos LI F3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5364
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (37.50%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → environmental samples → uncultured marine virus(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater → Extreme Environments Viral Communities From Various Locations

Source Dataset Sampling Location
Location NameMediterranean Sea
CoordinatesLat. (o)34.9283Long. (o)22.0216Alt. (m)Depth (m)3337
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F019751Metagenome / Metatranscriptome228N
F079216Metagenome / Metatranscriptome116Y

Sequences

Protein IDFamilyRBSSequence
Ga0256397_10001273F019751AGGVSNTLTRTRGPELSKDFKNYIFNQWMFFGKNAYQITETINKDTKLMSQFGKCSPAGVHYHIKNIEADLEDTISEDAMDTYIGEFIRARTGFENDVADVEDLMIHEKKKGLDDMDKELYLKLSRFRHEIKLDSFKMLQDSALPLQVKKLKMERNKLRPQKPVPEVINKVEEDGERTSE
Ga0256397_10001275F079216N/AMYDVCTKCDHGMILHGSVDGVGYCMEGNGNWCECTVEGLTYEQEIESLK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.