Scaffold Ga0256830_1089555

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0256830_1089555

Scaffold Ga0256830_1089555

Overview

Basic Information
Taxon OID	3300028399 Open in IMG/M
Scaffold ID	Ga0256830_1089555 Open in IMG/M
Source Dataset Name	Hydrothermal vent microbial communities from Lau Basin, Pacific Ocean - 128-326
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1085
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents → Marine Microbial Communities From Hydrothermal Vents In The Atlantic And Pacific Ocean

Source Dataset Sampling Location
Location Name	Pacific Ocean: Lau Basin
Coordinates	Lat. (^o)	-20.761	Long. (^o)	-176.1909	Alt. (m)		Depth (m)	2138
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F032091	Metagenome / Metatranscriptome	181	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0256830_10895552	F032091	N/A	IYDHLDLDIQYQHSDLFLDICKTVDEIDDERASLVLSYGHQMIEHIWMWTENIWSYYSNKNNPVPARTFDYYRD

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.