NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0304730_1000337

Scaffold Ga0304730_1000337


Overview

Basic Information
Taxon OID3300028394 Open in IMG/M
Scaffold IDGa0304730_1000337 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)41501
Total Scaffold Genes65 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)52 (80.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Montjoie, Canada
CoordinatesLat. (o)45.4091Long. (o)-72.0994Alt. (m)Depth (m)4
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003826Metagenome / Metatranscriptome466Y
F004641Metagenome / Metatranscriptome429Y
F041019Metagenome / Metatranscriptome160Y
F044497Metagenome / Metatranscriptome154Y

Sequences

Protein IDFamilyRBSSequence
Ga0304730_100033757F004641AGGAGMSEENKQDQKGAFIEKLLFALLPLLIGSTGYLIQALGSIQHDVTILNQKVSLVVTTDNKQASNSGAELAREKLRQDLEKEIQKNRDAIMENRQHIAILEDRAQVKNKIGSLKDH
Ga0304730_100033758F041019N/AMIDGVKSAATTLKGAQTAGKELGAVVTSQQADMEAIVQRDHKARITAKLAEEQRKSTLEYRALEKFESKLKYEQDVARLKAETIRKHGKDAWIKVEAEKALMEKERQAEMSAMDHDRQKQVDLLCWCFTAGALITYFFKLYKL
Ga0304730_100033762F044497GGAMLEWILALALAKEPDIKKWPEWECVRWTWTGDVYSRRVVCLEWRKRENRWIP
Ga0304730_100033763F003826AGGAGVDPITIGLAFTAAQTAVSHIKQAIALGKDINSLAGQFGKFFESSDAIHRERTKIKAKASRLGKTDAELGHEALQIAMHSDALRQAERELKDMILWQLGKPQIWEQMIQERTRLFKERAEAEQAEAERELARKKKMADHFMFGMYFIGVSIFLFAFIMAGVGVYGAMEEKRIYEQKVAARNALIRQQQKEREARERKERDDYAKN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.