Scaffold Ga0304729_1032536

Overview

Basic Information

• Taxon OID: 3300028392
• Scaffold ID: Ga0304729_1032536
• Source Dataset Name: Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2093
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium IMCC19121 (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location

• Location Name: Lake Croche, Canada
• Coordinates
  • Lat. (^o): 46.8319
  • Long. (^o): -72.5
  • Depth (m): 6

Associated Families

Family	Category	Number of Sequences	3D Structure?
F068283	Metagenome	125	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0304729_10325363	F068283	GGAG	MSQHAKDENFDQEVINSFGHEWAAFDYSEKETDGALDVQFAAYCTPID