NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0264393_10122

Scaffold Ga0264393_10122


Overview

Basic Information
Taxon OID3300028389 Open in IMG/M
Scaffold IDGa0264393_10122 Open in IMG/M
Source Dataset NameANME aggregate JGI 7061.QLV.BNCT.01.K10_combo
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5827
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (55.56%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment → Sediment Cell Enrichment Communities From Methane Seep In Santa Monica Basin, California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)33.0Long. (o)-118.0Alt. (m)Depth (m)860
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F068505Metagenome124Y

Sequences

Protein IDFamilyRBSSequence
Ga0264393_101223F068505GGGGGMKAILKIRNRGKRGYDISSIPMKKLEKMSHYRKKRWIIKKGFLVLEAF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.