Basic Information | |
---|---|
Taxon OID | 3300028387 Open in IMG/M |
Scaffold ID | Ga0264391_10255 Open in IMG/M |
Source Dataset Name | ANME aggregate JGI 7061.QLV.BNCT.01.D9_combo |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 4397 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales → Ignavibacteriaceae → Ignavibacterium → Ignavibacterium album | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment → Sediment Cell Enrichment Communities From Methane Seep In Santa Monica Basin, California, United States |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: California | |||||||
Coordinates | Lat. (o) | 33.0 | Long. (o) | -118.0 | Alt. (m) | Depth (m) | 860 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F066277 | Metagenome | 127 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0264391_102552 | F066277 | N/A | MDRKKFVALFSTSLLGAALLKANPFNFFAPKSNSKGSNSVKVKINPNAVNREKSGKKNG |
⦗Top⦘ |