Scaffold Ga0208280_1260

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0208280_1260

Scaffold Ga0208280_1260

Overview

Basic Information
Taxon OID	3300028323 Open in IMG/M
Scaffold ID	Ga0208280_1260 Open in IMG/M
Source Dataset Name	Saline lake microbial communities from Deep Lake, Antarctica, in enrichment culture - Antarctic Deep Lake Metagenome VIRHL14 (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	534
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location
Location Name	Deep Lake, Antarctica
Coordinates	Lat. (^o)	-68.5563	Long. (^o)	78.1877	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051583	Metagenome	144	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0208280_12602	F051583	GGCGG	MTPHVPLTVGRSAPEGTKPNMDYTNPEDVANIDEPTRQQEIGLLSGLVDGTFVCVNHRGFLVNRTDKGSIELSRDGEVLGGRYYVTENNFAGLVEWLNAKVALYGETA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.