Scaffold Ga0257108_1005117

Overview

Basic Information

• Taxon OID: 3300028190
• Scaffold ID: Ga0257108_1005117
• Source Dataset Name: Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_1000m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3776
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location

• Location Name: Canada: Northeast Subartic Pacific Ocean
• Coordinates
  • Lat. (^o): 50.0
  • Long. (^o): -145.0
  • Depth (m): 1000

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025142	Metagenome	203	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0257108_10051175	F025142	GAG	MVGRTTQFRVKAGSRAILQLTVADSSGTGKDLSNTTTYATGKWKVWKPSGTLLIDGNISFTTRSTGIVQYALTVADTVIANAGIWAGEVELKDASGNISEQTQTFQFIMEESY