NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0257118_1060568

Scaffold Ga0257118_1060568


Overview

Basic Information
Taxon OID3300028173 Open in IMG/M
Scaffold IDGa0257118_1060568 Open in IMG/M
Source Dataset NameMarine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_150m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)919
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → Candidatus Thermoprofundales → Marine Group III euryarchaeote CG-Epi3(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Inlet → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameCanada: British Columbia
CoordinatesLat. (o)48.6Long. (o)-123.5Alt. (m)Depth (m)150
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F064083Metagenome129N

Sequences

Protein IDFamilyRBSSequence
Ga0257118_10605681F064083N/ARTAHLEGDRIGIGIDHGMLDTIADIQAMHKLGAFRYLPLSVREMFFRTGKYHLPFNVDEAFSGNPKSRPWNTTAIVRMSLEVMRLYLMGLDPYMSRAMRNYLSVDLHKIGMKRMTNSVHRAGEFEKEFDYEDDADFDFTGLSDDDLTF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.