Scaffold Ga0265596_1046725

Overview

Basic Information

• Taxon OID: 3300028161
• Scaffold ID: Ga0265596_1046725
• Source Dataset Name: Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_06_06_60m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1184
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Source Dataset Sampling Location

• Location Name: Canada: Sakinaw lake, British Columbia
• Coordinates
  • Lat. (^o): 49.68
  • Long. (^o): -124.009
  • Depth (m): 60

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008189	Metagenome / Metatranscriptome	337	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0265596_10467252	F008189	N/A	MEYQNELKRLQEGSDYWKPKPGQYKVKALTELEVADPYVKKVTVDGKEQEEKTEQFKIKILVADEEKVWTFGKGKTPASTYGQLVELATKHGDQLTGVEFSVVIKSDGTKNDYIIVN