Scaffold Ga0255353_1004736

Overview

Basic Information

• Taxon OID: 3300028070
• Scaffold ID: Ga0255353_1004736
• Source Dataset Name: Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T25
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5465
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 6 (85.71%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil → Peatland Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location

• Location Name: Sweden: Norrbotten County, Stordalen Mire
• Coordinates
  • Lat. (^o): 68.3529
  • Long. (^o): 19.0475
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010304	Metagenome / Metatranscriptome	305	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0255353_10047367	F010304	AGGAG	MATNEQKPGSLDLESAARDKDQDEIREAAHTDKVVRGVNGSLAPKARKLRPLAGVILIGLVVLAAAYMRHGLANRNKKAAKQTETAKTGVGPATTIEKGMLSDQARNGLDTGQSHLPESLASRSSILTGEPPAGRSTSLAGTQANSIPPLE