Scaffold Ga0256405_10016796

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0256405_10016796

Scaffold Ga0256405_10016796

Overview

Basic Information
Taxon OID	3300028048 Open in IMG/M
Scaffold ID	Ga0256405_10016796 Open in IMG/M
Source Dataset Name	Bovine rumen microbial communities from Lethbridge, Alberta, Canada - RJG_02
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	8093
Total Scaffold Genes	8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	6 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Succinivibrionaceae	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen → Rumen Microbial Communities From Sheep, Dairy Cows And Beef Cattle From Various Locations

Source Dataset Sampling Location
Location Name	Canada: Alberta
Coordinates	Lat. (^o)	49.6935	Long. (^o)	-112.8418	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023997	Metagenome / Metatranscriptome	208	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0256405_100167966	F023997	GAGG	MITLKNWYKQQPEVVYFIQTNFQGDEFMKKLVRSEMSKEAWDKTVDRYSDCEIYKVITENHSGELHSWVYFKEGE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.